(data stored in ACNUC7421 zone)

EMBL: CP000675.PE365

CP000675.PE365       Location/Qualifiers
FT   CDS             complement(400982..401515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0370"
FT                   /product="chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54365"
FT                   /protein_id="ABQ54365.1"
FT                   /translation="MIKTFIEIIYSFGKIGLISLGGGNSMLKLLEYEAVTYRHWIGKEE
FT                   FVGMLGSSFLFPGLTGIKLAALIGYKAAGITGLILAIICLNLPGLIMALVGYQWLNSHN
FT                   GPITRKIMISVQYGALALLAAATFSVVQGVIDVYYSIPMAICCILFFLALAFWNLSPFY
FT                   GFLAFIAVCFFVVR"
     MIKTFIEIIY SFGKIGLISL GGGNSMLKLL EYEAVTYRHW IGKEEFVGML GSSFLFPGLT        60
     GIKLAALIGY KAAGITGLIL AIICLNLPGL IMALVGYQWL NSHNGPITRK IMISVQYGAL       120
     ALLAAATFSV VQGVIDVYYS IPMAICCILF FLALAFWNLS PFYGFLAFIA VCFFVVR          177
//

If you have problems or comments...

PBIL Back to PBIL home page