(data stored in ACNUC7421 zone)

EMBL: CP000675.PE368

CP000675.PE368       Location/Qualifiers
FT   CDS             404860..405552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54368"
FT                   /protein_id="ABQ54368.1"
FT                   /translation="MPKYTLPTRDALLKAMQVGETSIEAAEYMATRFEQILTQAKLLPE
FT                   CNDMLEKIQEYAQFVKFKLLSSAQVWSGQERPISDYQNMQENKAEFLASHLKELPSGLK
FT                   LEIAIGDDAKILRGFSSNGKMVEGEQLKTMDGLLEGWLAKNNLAISGGAVVQRNSTGNQ
FT                   TSVDPEEIRKLINDSEKGVAKYFADKGVSMEVVQRTYQEPKALETKREEIRQEIESGAE
FT                   APTTQSIR"
     MPKYTLPTRD ALLKAMQVGE TSIEAAEYMA TRFEQILTQA KLLPECNDML EKIQEYAQFV        60
     KFKLLSSAQV WSGQERPISD YQNMQENKAE FLASHLKELP SGLKLEIAIG DDAKILRGFS       120
     SNGKMVEGEQ LKTMDGLLEG WLAKNNLAIS GGAVVQRNST GNQTSVDPEE IRKLINDSEK       180
     GVAKYFADKG VSMEVVQRTY QEPKALETKR EEIRQEIESG AEAPTTQSIR                  230
//

If you have problems or comments...

PBIL Back to PBIL home page