(data stored in ACNUC7421 zone)

EMBL: CP000675.PE37

CP000675.PE37        Location/Qualifiers
FT   CDS             complement(43005..43727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54037"
FT                   /protein_id="ABQ54037.1"
FT                   /translation="MNYQYSPSLKKKLLLAFTTLFIVQMFYFAPVRASTRDTQLWTLMN
FT                   AIGPINKQHRKIRYWLEIQDRIGENISQLSQLILRPGIGYELLPTTTIWLGYDRIYTAQ
FT                   PFANPPVNENRVWQQLLWSKEYTRLRLTARSRLEERFIQRAIHTAWRYRQLFKTSIFIP
FT                   KHPKYAAVISDEAFFHLNDFNLQRNQGFDQNRLFVGLGYRTSKNSTIEIGYLNQMIKRV
FT                   NNPDYRGDYLSMALLLTE"
     MNYQYSPSLK KKLLLAFTTL FIVQMFYFAP VRASTRDTQL WTLMNAIGPI NKQHRKIRYW        60
     LEIQDRIGEN ISQLSQLILR PGIGYELLPT TTIWLGYDRI YTAQPFANPP VNENRVWQQL       120
     LWSKEYTRLR LTARSRLEER FIQRAIHTAW RYRQLFKTSI FIPKHPKYAA VISDEAFFHL       180
     NDFNLQRNQG FDQNRLFVGL GYRTSKNSTI EIGYLNQMIK RVNNPDYRGD YLSMALLLTE       240
//

If you have problems or comments...

PBIL Back to PBIL home page