(data stored in ACNUC7421 zone)

EMBL: CP000675.PE375

CP000675.PE375       Location/Qualifiers
FT   CDS             complement(412923..413468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54375"
FT                   /protein_id="ABQ54375.1"
FT                   /translation="MSKLVYLLLMIFFLNPAWANTHYHQHPVSPLANALRTGTDTNGNA
FT                   LYLCKAKLFNSIQPGKTWAGYGRCNVPYGGKEYVLSQFTIPNQNEFGRYSWEPNVEHAL
FT                   LMGKDTNGNPLFVCQSNFNGSIQPGKTWPGYSHCNISYGGREIITDNYRILSRPTEIIV
FT                   RTQPPVHRHPSQNRHYHY"
     MSKLVYLLLM IFFLNPAWAN THYHQHPVSP LANALRTGTD TNGNALYLCK AKLFNSIQPG        60
     KTWAGYGRCN VPYGGKEYVL SQFTIPNQNE FGRYSWEPNV EHALLMGKDT NGNPLFVCQS       120
     NFNGSIQPGK TWPGYSHCNI SYGGREIITD NYRILSRPTE IIVRTQPPVH RHPSQNRHYH       180
     Y                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page