(data stored in ACNUC7421 zone)

EMBL: CP000675.PE379

CP000675.PE379       Location/Qualifiers
FT   CDS             422160..422855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56924"
FT                   /db_xref="GOA:A5IHS4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS4"
FT                   /protein_id="ABQ56924.1"
FT                   /translation="MSKLTKKQKKIAEVIKPNQLYTVADAVAILKQFASKKFRESLDIS
FT                   INLGVDPRKSDQVVRSSTNLPKGTGKTVRVAVFAQGDNAAKATAAGADIVGFEDLADKI
FT                   KAGEMNFDVVIATPDAMRIVGQLGQILGPRGLMPNPKVGTVTTNVEAAVNDAKSGQVRY
FT                   RTDKNGIIHCTVGKADFAPEDVLENVVALINDLKKAKPASSKGQYLKKISLSTTMGPGL
FT                   PIDISSIPV"
     MSKLTKKQKK IAEVIKPNQL YTVADAVAIL KQFASKKFRE SLDISINLGV DPRKSDQVVR        60
     SSTNLPKGTG KTVRVAVFAQ GDNAAKATAA GADIVGFEDL ADKIKAGEMN FDVVIATPDA       120
     MRIVGQLGQI LGPRGLMPNP KVGTVTTNVE AAVNDAKSGQ VRYRTDKNGI IHCTVGKADF       180
     APEDVLENVV ALINDLKKAK PASSKGQYLK KISLSTTMGP GLPIDISSIP V                231
//

If you have problems or comments...

PBIL Back to PBIL home page