(data stored in ACNUC7421 zone)

EMBL: CP000675.PE385

CP000675.PE385       Location/Qualifiers
FT   CDS             432979..433506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56918"
FT                   /db_xref="GOA:A5IHR8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR8"
FT                   /protein_id="ABQ56918.1"
FT                   /translation="MPRRREVPKREILPDPKHHSELLAKFINVLMVSGKKSIAEKITYG
FT                   ALSVMEERVKKIKKNEEDGSETGSSGSAGAVLRYFEEALDNVRPSVEVRSRRVGGATYQ
FT                   VPVEVRHDRSIALGMRWIVQAARTRGEKGMMLRLAGELMDAYENKGSAVKKREDTHKMA
FT                   KANQAFAHFRWN"
     MPRRREVPKR EILPDPKHHS ELLAKFINVL MVSGKKSIAE KITYGALSVM EERVKKIKKN        60
     EEDGSETGSS GSAGAVLRYF EEALDNVRPS VEVRSRRVGG ATYQVPVEVR HDRSIALGMR       120
     WIVQAARTRG EKGMMLRLAG ELMDAYENKG SAVKKREDTH KMAKANQAFA HFRWN            175
//

If you have problems or comments...

PBIL Back to PBIL home page