(data stored in ACNUC7421 zone)

EMBL: CP000675.PE406

CP000675.PE406       Location/Qualifiers
FT   CDS             444775..445281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2996"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2996"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56897"
FT                   /db_xref="GOA:A5IHP7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP7"
FT                   /protein_id="ABQ56897.1"
FT                   /translation="MSFDELPKSDGYQEKLVSVTRTAKVVKGGRVFGFAVLVVVGDGKG
FT                   KVGFGRGKAREVPIAIQKAMDQAKKNMVYIPLSGTTIFHEITWNYGASKVFMKPASEGT
FT                   GIIAGGAMRAVLEVLGVQNILAKSIGSTNPSNIVRATIGALTHIGTPDYVAAKRGKTVE
FT                   EVMAG"
     MSFDELPKSD GYQEKLVSVT RTAKVVKGGR VFGFAVLVVV GDGKGKVGFG RGKAREVPIA        60
     IQKAMDQAKK NMVYIPLSGT TIFHEITWNY GASKVFMKPA SEGTGIIAGG AMRAVLEVLG       120
     VQNILAKSIG STNPSNIVRA TIGALTHIGT PDYVAAKRGK TVEEVMAG                    168
//

If you have problems or comments...

PBIL Back to PBIL home page