(data stored in ACNUC7421 zone)

EMBL: CP000675.PE407

CP000675.PE407       Location/Qualifiers
FT   CDS             445469..445903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2995"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56896"
FT                   /db_xref="GOA:A5IHP6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP6"
FT                   /protein_id="ABQ56896.1"
FT                   /translation="MNLNTLSPDPGSRPSRRRVGRGIGSGLGKTCGKGHKGQKSRAGGY
FT                   HKINFEGGQMPIQRRLPKMGFKSREGRTIDEVSLGELAKLNDEVIDLVALRKAGLINNS
FT                   IKDVKVILSGELTAAIKLKGLRVTKGARSAIESLGGSIEE"
     MNLNTLSPDP GSRPSRRRVG RGIGSGLGKT CGKGHKGQKS RAGGYHKINF EGGQMPIQRR        60
     LPKMGFKSRE GRTIDEVSLG ELAKLNDEVI DLVALRKAGL INNSIKDVKV ILSGELTAAI       120
     KLKGLRVTKG ARSAIESLGG SIEE                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page