(data stored in ACNUC7421 zone)

EMBL: CP000675.PE41

CP000675.PE41        Location/Qualifiers
FT   CDS             complement(47130..48125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0041"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54041"
FT                   /protein_id="ABQ54041.1"
FT                   /translation="MDPITHGVLGAACAQAAFGKFDKRIPWQAGALAGMAPDLDVFIRF
FT                   SQEPLSLEQWHRYLTHSLMFIPIGGLVVALFLLCFSQYRQYWKVTIGASLVGYATHCLL
FT                   DSLTSYGTVLFWPWSDSRISWDIISIIDPVFTLPLLLGTAWSVIYQNQKAVTASLFFCI
FT                   LFLIFNTILHNRAVDGIHQYATSNNFKINHPRALPKLASSTDWRIIAKQQDCLIIAEAK
FT                   TSLFYPTTIRLIRKALSFNESMIPFALSSGQKSDLATFHWFTDGFLIVANKNPLILADA
FT                   RYTIDDSPIFSLWGIEILPGQEHINKLSLPKINEYCKSPDSESYNENGLN"
     MDPITHGVLG AACAQAAFGK FDKRIPWQAG ALAGMAPDLD VFIRFSQEPL SLEQWHRYLT        60
     HSLMFIPIGG LVVALFLLCF SQYRQYWKVT IGASLVGYAT HCLLDSLTSY GTVLFWPWSD       120
     SRISWDIISI IDPVFTLPLL LGTAWSVIYQ NQKAVTASLF FCILFLIFNT ILHNRAVDGI       180
     HQYATSNNFK INHPRALPKL ASSTDWRIIA KQQDCLIIAE AKTSLFYPTT IRLIRKALSF       240
     NESMIPFALS SGQKSDLATF HWFTDGFLIV ANKNPLILAD ARYTIDDSPI FSLWGIEILP       300
     GQEHINKLSL PKINEYCKSP DSESYNENGL N                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page