(data stored in ACNUC7421 zone)

EMBL: CP000675.PE423

CP000675.PE423       Location/Qualifiers
FT   CDS             complement(458580..461270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2979"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2979"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56880"
FT                   /protein_id="ABQ56880.1"
FT                   /translation="MVDFDKPVSKNDILASLLLIADLNRPSLNQTLSWEQALKSFLSLN
FT                   DPLIKTEIFIKWLSQLNPDQLQSSPEIVLILKHIVEQKLLPYTLKKILIQRKNFTTSQI
FT                   NWLCNHCLIVAPDQTTLPDIIKLGSWSWLENHMKRNELLNFDLLKIAILNKDYLASINN
FT                   SKESQLDFIYALNANKFNYQQILELIALAQDSQIKSLLITCLLSKKEYLDNLKEKSFLA
FT                   HLNQSEFHSPPRLNALVHQLNLSCLTVAQIELLQPEACVTLLCSIPHFHQLSEKQVEKI
FT                   LLKYPKPDMIAYWLNHYSSRPNAHFILAHLMNLVDVHVVDELNKMDSTKKETIIMNMVE
FT                   HLELFDPTHPLLINQNEEKRLITAIQRYLYGQHHDAYVTYIKLLVYKLLNRNYQFSPQA
FT                   MQLLICLNNLEELKELNNKIAYLTNYYLRASAQSGDSSLFYNDSRINITSMTQLVQLAP
FT                   KIPTKSKEKSLLSSLFCGIKISESSVMTPTNDIPEHPLINKLIKSKRTVKSIDYFLMHY
FT                   KGDKQVLSKIINDYLSYYVQEGCTEIHRRSIYHLIVLMSLSDISASVREAIYTAFLNYP
FT                   ELHDEQINFSLFIYDAKRTIRHFGAQASEDSYARVIDLCEGALKKLNPNKHKEIISIAT
FT                   QALTEAKIELSFGENTGFIAQLISRLKRCWYYGWTGFFSPNLPAFVAAIDSPIKQSEKK
FT                   ASPLLQQRKYFTTKLETNLSIILDDIKSGYTQQKLNELIEALSIFSLQSNPKNELKIRQ
FT                   KLHRLFHYLLLESKNDLTLDAWLIKNQQLLIANRFRLLEMQLMKGARNEVESLLKEFDE
FT                   DSTHFSPIIKEFTHSLPEQNPYRCESVSSNQTPGITILDSATELATSLKSTLGNLGVFF
FT                   SNNIMSAIYPNNKSTPQSTSTMISP"
     MVDFDKPVSK NDILASLLLI ADLNRPSLNQ TLSWEQALKS FLSLNDPLIK TEIFIKWLSQ        60
     LNPDQLQSSP EIVLILKHIV EQKLLPYTLK KILIQRKNFT TSQINWLCNH CLIVAPDQTT       120
     LPDIIKLGSW SWLENHMKRN ELLNFDLLKI AILNKDYLAS INNSKESQLD FIYALNANKF       180
     NYQQILELIA LAQDSQIKSL LITCLLSKKE YLDNLKEKSF LAHLNQSEFH SPPRLNALVH       240
     QLNLSCLTVA QIELLQPEAC VTLLCSIPHF HQLSEKQVEK ILLKYPKPDM IAYWLNHYSS       300
     RPNAHFILAH LMNLVDVHVV DELNKMDSTK KETIIMNMVE HLELFDPTHP LLINQNEEKR       360
     LITAIQRYLY GQHHDAYVTY IKLLVYKLLN RNYQFSPQAM QLLICLNNLE ELKELNNKIA       420
     YLTNYYLRAS AQSGDSSLFY NDSRINITSM TQLVQLAPKI PTKSKEKSLL SSLFCGIKIS       480
     ESSVMTPTND IPEHPLINKL IKSKRTVKSI DYFLMHYKGD KQVLSKIIND YLSYYVQEGC       540
     TEIHRRSIYH LIVLMSLSDI SASVREAIYT AFLNYPELHD EQINFSLFIY DAKRTIRHFG       600
     AQASEDSYAR VIDLCEGALK KLNPNKHKEI ISIATQALTE AKIELSFGEN TGFIAQLISR       660
     LKRCWYYGWT GFFSPNLPAF VAAIDSPIKQ SEKKASPLLQ QRKYFTTKLE TNLSIILDDI       720
     KSGYTQQKLN ELIEALSIFS LQSNPKNELK IRQKLHRLFH YLLLESKNDL TLDAWLIKNQ       780
     QLLIANRFRL LEMQLMKGAR NEVESLLKEF DEDSTHFSPI IKEFTHSLPE QNPYRCESVS       840
     SNQTPGITIL DSATELATSL KSTLGNLGVF FSNNIMSAIY PNNKSTPQST STMISP           896
//

If you have problems or comments...

PBIL Back to PBIL home page