(data stored in ACNUC7421 zone)

EMBL: CP000675.PE425

CP000675.PE425       Location/Qualifiers
FT   CDS             complement(462713..463075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2977"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56878"
FT                   /protein_id="ABQ56878.1"
FT                   /translation="MSILFLARKLASDYGFIEQIQQSHNRNQINYRFYSPRTDLHGSNT
FT                   NRLYGNPGKGVISQNTIFIYWYRDGKNSYFIECSNRLPKKELEVLHQLLMDNQHSLEEI
FT                   LEASNNRFLSFQTRHT"
     MSILFLARKL ASDYGFIEQI QQSHNRNQIN YRFYSPRTDL HGSNTNRLYG NPGKGVISQN        60
     TIFIYWYRDG KNSYFIECSN RLPKKELEVL HQLLMDNQHS LEEILEASNN RFLSFQTRHT       120
//

If you have problems or comments...

PBIL Back to PBIL home page