(data stored in ACNUC7421 zone)

EMBL: CP000675.PE427

CP000675.PE427       Location/Qualifiers
FT   CDS             463909..464343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2975"
FT                   /product="oligoketide cyclase/lipid transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2975"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56876"
FT                   /protein_id="ABQ56876.1"
FT                   /translation="MTIVKRSRTVPYSCEQMYGLVNDVEHYSEFLPYCAESKILHRDND
FT                   EVQATLVIAAAGMSKSFTTRNRLQTNKMIEIRLVDGPFSHLEGFWRFDQEEKGCRISFD
FT                   LEFEFAGKIFSMLLGPIFDQITDKMVDAFCERAEVIYGKG"
     MTIVKRSRTV PYSCEQMYGL VNDVEHYSEF LPYCAESKIL HRDNDEVQAT LVIAAAGMSK        60
     SFTTRNRLQT NKMIEIRLVD GPFSHLEGFW RFDQEEKGCR ISFDLEFEFA GKIFSMLLGP       120
     IFDQITDKMV DAFCERAEVI YGKG                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page