(data stored in ACNUC7421 zone)

EMBL: CP000675.PE428

CP000675.PE428       Location/Qualifiers
FT   CDS             464330..464602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2974"
FT                   /product="conserved hypothetical protein; UPF0125"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2974"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56875"
FT                   /protein_id="ABQ56875.1"
FT                   /translation="MVKVELVYIADSKNCLHYKMDLKQGATVEEALIESNIYSTCPETR
FT                   ELPVGVYGKRVSVDQVLKEGDRIEIYRPLILDPKEKRRKLAQFKK"
     MVKVELVYIA DSKNCLHYKM DLKQGATVEE ALIESNIYST CPETRELPVG VYGKRVSVDQ        60
     VLKEGDRIEI YRPLILDPKE KRRKLAQFKK                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page