(data stored in ACNUC7421 zone)

EMBL: CP000675.PE431

CP000675.PE431       Location/Qualifiers
FT   CDS             465780..465923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2971"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2971"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56872"
FT                   /protein_id="ABQ56872.1"
FT                   /translation="MEFDYIIVSDGSPGWAFASRLSANPANKLLLLEAGDSVFLEMPIR
FT                   LQ"
     MEFDYIIVSD GSPGWAFASR LSANPANKLL LLEAGDSVFL EMPIRLQ                      47
//

If you have problems or comments...

PBIL Back to PBIL home page