(data stored in ACNUC7421 zone)

EMBL: CP000675.PE437

CP000675.PE437       Location/Qualifiers
FT   CDS             complement(473927..475147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2965"
FT                   /product="conserved hypothetical protein; AF2307 from
FT                   Archaeoglobus fulgidus"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2965"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56866"
FT                   /protein_id="ABQ56866.1"
FT                   /translation="MSDFPIFSVLGIEIEYMLVDKESLNVQPKSDLILRTLAGHQVNEI
FT                   ELGDIAISNELVLHVLELKNNGPKPLHVPVAEHFQKTIRELQPLLAQHNLLLLPTGAHP
FT                   WMDPNTETIRWPHGNHDIYNQFNSIFNCQGHGWANLQSMHVNLPYSNEEEFCQLHNAIR
FT                   LILPLLPAIAASTPFLDGQATGLLDSRLYFYSRNQQRIPSISGDIIPEFIRTEREYQEQ
FT                   ILEPMYRDISPYDPKGILQYQWLNSRAAIPKFDMKAIEIRILDSQECVEADIAIAKAIN
FT                   AILKYWQSTSNFYLDNPCDTKSLKYVFDETIKNGLSCHIDNKKLLEQWQLPLQGMSVNT
FT                   IWSLLIERISHELDRKQQLALELILKQGNLSERILKACSSSINHDSLKQVYTQLAHCLL
FT                   RNEQFTP"
     MSDFPIFSVL GIEIEYMLVD KESLNVQPKS DLILRTLAGH QVNEIELGDI AISNELVLHV        60
     LELKNNGPKP LHVPVAEHFQ KTIRELQPLL AQHNLLLLPT GAHPWMDPNT ETIRWPHGNH       120
     DIYNQFNSIF NCQGHGWANL QSMHVNLPYS NEEEFCQLHN AIRLILPLLP AIAASTPFLD       180
     GQATGLLDSR LYFYSRNQQR IPSISGDIIP EFIRTEREYQ EQILEPMYRD ISPYDPKGIL       240
     QYQWLNSRAA IPKFDMKAIE IRILDSQECV EADIAIAKAI NAILKYWQST SNFYLDNPCD       300
     TKSLKYVFDE TIKNGLSCHI DNKKLLEQWQ LPLQGMSVNT IWSLLIERIS HELDRKQQLA       360
     LELILKQGNL SERILKACSS SINHDSLKQV YTQLAHCLLR NEQFTP                      406
//

If you have problems or comments...

PBIL Back to PBIL home page