(data stored in ACNUC7421 zone)

EMBL: CP000675.PE440

CP000675.PE440       Location/Qualifiers
FT   CDS             complement(477506..477979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2962"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2962"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56863"
FT                   /protein_id="ABQ56863.1"
FT                   /translation="MSPLTQFKFFLWFFSHFKVALIGYLKPKLIQLTDNEIVVRLPLTR
FT                   RSRNHLHSMYFGALAVGADIAGGLHGFYHAKQAKCKVSLAFKSFQAQFLRRPESDVYFI
FT                   CTEGEVVKKMIEESKKSGERINKPIHIKAYINYLTHPEEIADFILELSLKVIK"
     MSPLTQFKFF LWFFSHFKVA LIGYLKPKLI QLTDNEIVVR LPLTRRSRNH LHSMYFGALA        60
     VGADIAGGLH GFYHAKQAKC KVSLAFKSFQ AQFLRRPESD VYFICTEGEV VKKMIEESKK       120
     SGERINKPIH IKAYINYLTH PEEIADFILE LSLKVIK                                157
//

If you have problems or comments...

PBIL Back to PBIL home page