(data stored in ACNUC7421 zone)

EMBL: CP000675.PE442

CP000675.PE442       Location/Qualifiers
FT   CDS             complement(478786..479244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2960"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2960"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56861"
FT                   /protein_id="ABQ56861.1"
FT                   /translation="MKSLIKNLLFIVVFSINSSALYAANGNTRVIQWAQQTLMDTLSVS
FT                   YTSKAQDFVTVRKNYSLNAWSGITGFLGGNMQTIREKQLTLHPVLLPDTQILSTGLYSG
FT                   MSYWIIRQSVAIDELNTKLTFTLTILGRSGAAGYPYIVHSLSILLNAL"
     MKSLIKNLLF IVVFSINSSA LYAANGNTRV IQWAQQTLMD TLSVSYTSKA QDFVTVRKNY        60
     SLNAWSGITG FLGGNMQTIR EKQLTLHPVL LPDTQILSTG LYSGMSYWII RQSVAIDELN       120
     TKLTFTLTIL GRSGAAGYPY IVHSLSILLN AL                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page