(data stored in ACNUC7421 zone)

EMBL: CP000675.PE444

CP000675.PE444       Location/Qualifiers
FT   CDS             482378..482959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2958"
FT                   /product="LemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2958"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56859"
FT                   /protein_id="ABQ56859.1"
FT                   /translation="MKTFFIAILIIIALAFIWAISIYNTLIGLIEAINNNKKQIDIQLD
FT                   RRFKVFESLIEAVKKYMDYEKTTLKDVVALRNQAQAAKEAGDEQGRIAAENGISKIASN
FT                   LNLVFEQYPDLKASQNVMQLQEEIVNTENKLAYAKQAYNDGIERYNAKKKSFFESMVVA
FT                   MFSSALDKEFIYWGLPEEQIQAKENYTVKL"
     MKTFFIAILI IIALAFIWAI SIYNTLIGLI EAINNNKKQI DIQLDRRFKV FESLIEAVKK        60
     YMDYEKTTLK DVVALRNQAQ AAKEAGDEQG RIAAENGISK IASNLNLVFE QYPDLKASQN       120
     VMQLQEEIVN TENKLAYAKQ AYNDGIERYN AKKKSFFESM VVAMFSSALD KEFIYWGLPE       180
     EQIQAKENYT VKL                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page