(data stored in ACNUC7421 zone)

EMBL: CP000675.PE445

CP000675.PE445       Location/Qualifiers
FT   CDS             482970..483989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="LPC_2957"
FT                   /product="heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2957"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56858"
FT                   /protein_id="ABQ56858.1"
FT                   /translation="MGIADYHATAGDWRAQLRRNEKKTRRVIAVFFLVYILVGLIVDAF
FT                   VLQGMYPHASLENIIRALITFKVVPIATLLMIAFAGISLLITYALYDRIMLLGTEYYQI
FT                   TPETARSLQEKQLYNVVEEMKVASGLQYMPKVYIIEASYMNAFASGYSEKSAMVAITRG
FT                   LMEKLDRAEMQAVMAHELSHIRHHDIKLTLMVAVLSNILLIVIDILFYSVIYKRDRRGD
FT                   NRLLMVIIILRYVLPIITVLLALFLSRTREYMADAGCVELMRDNEPMARALLKINQDHV
FT                   QNAEQYAKAYGDTPHEQVRQASYLFDPSHIDPVKSLNNAFSTHPSIEQRLEALGFKRK"
     MGIADYHATA GDWRAQLRRN EKKTRRVIAV FFLVYILVGL IVDAFVLQGM YPHASLENII        60
     RALITFKVVP IATLLMIAFA GISLLITYAL YDRIMLLGTE YYQITPETAR SLQEKQLYNV       120
     VEEMKVASGL QYMPKVYIIE ASYMNAFASG YSEKSAMVAI TRGLMEKLDR AEMQAVMAHE       180
     LSHIRHHDIK LTLMVAVLSN ILLIVIDILF YSVIYKRDRR GDNRLLMVII ILRYVLPIIT       240
     VLLALFLSRT REYMADAGCV ELMRDNEPMA RALLKINQDH VQNAEQYAKA YGDTPHEQVR       300
     QASYLFDPSH IDPVKSLNNA FSTHPSIEQR LEALGFKRK                              339
//

If you have problems or comments...

PBIL Back to PBIL home page