(data stored in ACNUC7421 zone)

EMBL: CP000675.PE446

CP000675.PE446       Location/Qualifiers
FT   CDS             complement(484016..484789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2956"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2956"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56857"
FT                   /protein_id="ABQ56857.1"
FT                   /translation="MGFKYQLIALYTLVRREVVRMFRISSQVFLPPVITTTLYFLIFGS
FT                   LIGPRIGDIEGVDYSQFIAPGLIMMSVIINSYGNVSNSLFSVRFQKSIEEMLISPMHNG
FT                   LLLLGYVIGGVLRGLIVAILVFVISTFFLPVELDHLPMTLLVVVLVAAIFSLAGFTNAM
FT                   VARNFDDIMLIPTFILTPLTYLGGVFYSINMLPPFWQKISLFNPILYMVNALRHTMIDQ
FT                   EEVSITLAMIIIFLMLIALTVGNMILLKKGVGFRE"
     MGFKYQLIAL YTLVRREVVR MFRISSQVFL PPVITTTLYF LIFGSLIGPR IGDIEGVDYS        60
     QFIAPGLIMM SVIINSYGNV SNSLFSVRFQ KSIEEMLISP MHNGLLLLGY VIGGVLRGLI       120
     VAILVFVIST FFLPVELDHL PMTLLVVVLV AAIFSLAGFT NAMVARNFDD IMLIPTFILT       180
     PLTYLGGVFY SINMLPPFWQ KISLFNPILY MVNALRHTMI DQEEVSITLA MIIIFLMLIA       240
     LTVGNMILLK KGVGFRE                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page