(data stored in ACNUC7421 zone)

EMBL: CP000675.PE448

CP000675.PE448       Location/Qualifiers
FT   CDS             complement(485924..486943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2954"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2954"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56855"
FT                   /protein_id="ABQ56855.1"
FT                   /translation="MPISNAFLKLFSEFVDNYARNGTPSFYHWAKEQNHEVINKFFHEL
FT                   LEIIKSNTETFHDVSIIEHLNATVLLSAKTNPYLLDCWISFITKYNAETNSFTPIGASM
FT                   HIKIGPEGTPSERIIRELKESLVMTQQAFILAQKANATEVDSLKRQLERTKLENERLVT
FT                   QNQFLKDQVRAEKTFADINPQINNARHQLSALTELIQTLSEITNAKPKIETVSSLSIPA
FT                   VTENKSELLKENSCSVAPVSKEVTPAISQEPKKRPVPPPPNDMDSQALFPNIPPKEDVS
FT                   IKVTIPSMPKPNSTQPVAKNSGFFSGDGFLKELNAKIKERKERPKDEPHTTPVEKKNL"
     MPISNAFLKL FSEFVDNYAR NGTPSFYHWA KEQNHEVINK FFHELLEIIK SNTETFHDVS        60
     IIEHLNATVL LSAKTNPYLL DCWISFITKY NAETNSFTPI GASMHIKIGP EGTPSERIIR       120
     ELKESLVMTQ QAFILAQKAN ATEVDSLKRQ LERTKLENER LVTQNQFLKD QVRAEKTFAD       180
     INPQINNARH QLSALTELIQ TLSEITNAKP KIETVSSLSI PAVTENKSEL LKENSCSVAP       240
     VSKEVTPAIS QEPKKRPVPP PPNDMDSQAL FPNIPPKEDV SIKVTIPSMP KPNSTQPVAK       300
     NSGFFSGDGF LKELNAKIKE RKERPKDEPH TTPVEKKNL                              339
//

If you have problems or comments...

PBIL Back to PBIL home page