(data stored in ACNUC7421 zone)

EMBL: CP000675.PE449

CP000675.PE449       Location/Qualifiers
FT   CDS             complement(487069..487707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2953"
FT                   /product="SM20-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2953"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56854"
FT                   /protein_id="ABQ56854.1"
FT                   /translation="MFNPDLIAHNICTQGFHIIDEFLEEAHYYSLRDMAYELKQQNLFR
FT                   NAKIGQNLQAQQNDKIRSDQIFWIDADSPYPPIQAYLKKLISLGNVLNQTMYLGLAEFE
FT                   THFAIYLPGTFYRKHIDQFESTKTRKISFVYYLNDTWQKEFGGELLLYNIEDELIQNIS
FT                   PLGNRFVCFDSQLPHEVHPTQRTRFSMTGWMKTRSTSVLADNKLTQITQ"
     MFNPDLIAHN ICTQGFHIID EFLEEAHYYS LRDMAYELKQ QNLFRNAKIG QNLQAQQNDK        60
     IRSDQIFWID ADSPYPPIQA YLKKLISLGN VLNQTMYLGL AEFETHFAIY LPGTFYRKHI       120
     DQFESTKTRK ISFVYYLNDT WQKEFGGELL LYNIEDELIQ NISPLGNRFV CFDSQLPHEV       180
     HPTQRTRFSM TGWMKTRSTS VLADNKLTQI TQ                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page