(data stored in ACNUC7421 zone)

EMBL: CP000675.PE452

CP000675.PE452       Location/Qualifiers
FT   CDS             complement(488685..488966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2950"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56851"
FT                   /protein_id="ABQ56851.1"
FT                   /translation="MKNKLAMSILLFLLPTAAAMANCDLTKFRWDCDLPVQVKPSPGAS
FT                   SLVYCGSSYGYITKQQYDILARYQRASVNMVLDINGEYIDSPCIGAER"
     MKNKLAMSIL LFLLPTAAAM ANCDLTKFRW DCDLPVQVKP SPGASSLVYC GSSYGYITKQ        60
     QYDILARYQR ASVNMVLDIN GEYIDSPCIG AER                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page