(data stored in ACNUC7421 zone)

EMBL: CP000675.PE468

CP000675.PE468       Location/Qualifiers
FT   CDS             501413..502141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2934"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3346"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2934"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56835"
FT                   /protein_id="ABQ56835.1"
FT                   /translation="MPSLTCFNFRFTSNWPMLILTAVCFFLFISLGFWQIHRADEKTEM
FT                   ITAQQALAKKEPIIWQPGQKLPEQYQRISIEGAFLPKLFLLDNQHYQHQFGYDVVSPML
FT                   LDDGSIVMVDRGWVSGDITRRTFPNVQTPNGKFKLFGMVYFPSKKQWILGPSFEEKENK
FT                   VTLLELIDEEILKQLLQKKVYPFIIRLDKNEPFGFVREWEIVSMPPQRHFAYAIQWFAM
FT                   ALVILIIFVIFNLKKNEKTI"
     MPSLTCFNFR FTSNWPMLIL TAVCFFLFIS LGFWQIHRAD EKTEMITAQQ ALAKKEPIIW        60
     QPGQKLPEQY QRISIEGAFL PKLFLLDNQH YQHQFGYDVV SPMLLDDGSI VMVDRGWVSG       120
     DITRRTFPNV QTPNGKFKLF GMVYFPSKKQ WILGPSFEEK ENKVTLLELI DEEILKQLLQ       180
     KKVYPFIIRL DKNEPFGFVR EWEIVSMPPQ RHFAYAIQWF AMALVILIIF VIFNLKKNEK       240
     TI                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page