(data stored in ACNUC7421 zone)

EMBL: CP000675.PE470

CP000675.PE470       Location/Qualifiers
FT   CDS             502675..503682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2932"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2932"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56833"
FT                   /protein_id="ABQ56833.1"
FT                   /translation="MSNSSIRLAATLAVFLAFFVVMLGAYTRLTDAGLGCPDWPGCYGR
FT                   MVLPGADKGLQEAQSQYPDLPIESKKAWTEMAHRYAAGTLALLIFFIAFQVWFKRRQDQ
FT                   DLPWHLPLALFMLVVFQAALGMWTVTLKLLPVVVMGHLLGGMLIVACLCRFRLQIAQLK
FT                   GQNLPEWRPWLRLGIVIILLQIALGGWVSANYAGISCIGFPLCNGTWFPELHFAKGFNL
FT                   FSTIGANYQGGVLESEVRASIQFIHRIGAILTATYLLALSLIIVFKTHSIYLRATAVIM
FT                   AMLVLLQFTLGIMNVIHLLPLKVAVAHNGVAALLLAVAFCSLHFTQDREVSHAY"
     MSNSSIRLAA TLAVFLAFFV VMLGAYTRLT DAGLGCPDWP GCYGRMVLPG ADKGLQEAQS        60
     QYPDLPIESK KAWTEMAHRY AAGTLALLIF FIAFQVWFKR RQDQDLPWHL PLALFMLVVF       120
     QAALGMWTVT LKLLPVVVMG HLLGGMLIVA CLCRFRLQIA QLKGQNLPEW RPWLRLGIVI       180
     ILLQIALGGW VSANYAGISC IGFPLCNGTW FPELHFAKGF NLFSTIGANY QGGVLESEVR       240
     ASIQFIHRIG AILTATYLLA LSLIIVFKTH SIYLRATAVI MAMLVLLQFT LGIMNVIHLL       300
     PLKVAVAHNG VAALLLAVAF CSLHFTQDRE VSHAY                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page