(data stored in ACNUC7421 zone)

EMBL: CP000675.PE474

CP000675.PE474       Location/Qualifiers
FT   CDS             complement(506485..506730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2928"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2928"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56829"
FT                   /protein_id="ABQ56829.1"
FT                   /translation="MLNKRFSERLNKELDNIGVPEATAERIEILSKLIKIPKFKAEALL
FT                   NGITIPDEAVLKTLAQELEVNVDWLIGKSDSKSGAH"
     MLNKRFSERL NKELDNIGVP EATAERIEIL SKLIKIPKFK AEALLNGITI PDEAVLKTLA        60
     QELEVNVDWL IGKSDSKSGA H                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page