(data stored in ACNUC7421 zone)

EMBL: CP000675.PE48

CP000675.PE48        Location/Qualifiers
FT   CDS             53472..53870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54048"
FT                   /protein_id="ABQ54048.1"
FT                   /translation="MNCFPFFAKKNKKNNEEKAEKTLSVFPAGTSINKTTVKEICFTDI
FT                   FCDTHPFVWYYYPEHNLAIWTSRLAGTTQEYPVDYLLNQLAKIPGITIDQGDAAIKDVS
FT                   TFLQDHQMIPIRNSESWRYIKSSSFSMS"
     MNCFPFFAKK NKKNNEEKAE KTLSVFPAGT SINKTTVKEI CFTDIFCDTH PFVWYYYPEH        60
     NLAIWTSRLA GTTQEYPVDY LLNQLAKIPG ITIDQGDAAI KDVSTFLQDH QMIPIRNSES       120
     WRYIKSSSFS MS                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page