(data stored in ACNUC7421 zone)

EMBL: CP000675.PE486

CP000675.PE486       Location/Qualifiers
FT   CDS             518360..518791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2916"
FT                   /product="diadenosine tetraphosphate (Ap4A) hydrolase,
FT                   histidine triad family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2916"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56817"
FT                   /protein_id="ABQ56817.1"
FT                   /translation="MFCIDDRIKSSSFILGEWPLSTVLLKNDASYPWFILVPRKMDIQE
FT                   IYQLEKSERFLLIEEINQLSLLVRDYFKPDKLNIGALGNIVPQLHIHIVIRSKNDPLWP
FT                   QGIWQSSMPSIPYPESELKSLLPTLGDLVRAYDKPQSLC"
     MFCIDDRIKS SSFILGEWPL STVLLKNDAS YPWFILVPRK MDIQEIYQLE KSERFLLIEE        60
     INQLSLLVRD YFKPDKLNIG ALGNIVPQLH IHIVIRSKND PLWPQGIWQS SMPSIPYPES       120
     ELKSLLPTLG DLVRAYDKPQ SLC                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page