(data stored in ACNUC7421 zone)

EMBL: CP000675.PE487

CP000675.PE487       Location/Qualifiers
FT   CDS             complement(519005..519433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2915"
FT                   /product="glyoxylase domain hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2915"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56816"
FT                   /protein_id="ABQ56816.1"
FT                   /translation="MFIIVIYNSSNGESIFKFQQGALMIKKIAFTMYPVQNMDRARQFY
FT                   EKTLGIKVGKISAEGAWVEYDLPQGGCFAITTLAQGVIPSANSGGSVAFEVDNLDELVF
FT                   QLKSKGVQFKIDLFASPVCRMAIAVDSEGNAFTLHQLT"
     MFIIVIYNSS NGESIFKFQQ GALMIKKIAF TMYPVQNMDR ARQFYEKTLG IKVGKISAEG        60
     AWVEYDLPQG GCFAITTLAQ GVIPSANSGG SVAFEVDNLD ELVFQLKSKG VQFKIDLFAS       120
     PVCRMAIAVD SEGNAFTLHQ LT                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page