(data stored in ACNUC7421 zone)

EMBL: CP000675.PE490

CP000675.PE490       Location/Qualifiers
FT   CDS             521958..522890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2912"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2912"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56813"
FT                   /protein_id="ABQ56813.1"
FT                   /translation="MSMSKFIEWIDKVDPYAVQRIALYKSLFIATVMAYVYWVFRPTNF
FT                   TAFFSPFLLVRFYESPSLTSFKEKEHFLIFIGVVVVLLSTSFYLVYPFRVVFFFFSIIA
FT                   LASVYFYVLKNYLPLRNVTMLIIASGATILSTEPPANWQIVYDIVGSSALSMIAIFICL
FT                   RFFPNQYLSVWKRALAKFIQSLEQDIEGSFSHRGPRFMQEEMTHLGMLRQYRRLIPKKY
FT                   MIYTQRISINIRNIQFSLDNLYYEAKNEAFWHGVKENLYTLRCAIKTNTSCDTPKMSIV
FT                   PESKLQQYVMRCLQQAFSHWNRLCMILQH"
     MSMSKFIEWI DKVDPYAVQR IALYKSLFIA TVMAYVYWVF RPTNFTAFFS PFLLVRFYES        60
     PSLTSFKEKE HFLIFIGVVV VLLSTSFYLV YPFRVVFFFF SIIALASVYF YVLKNYLPLR       120
     NVTMLIIASG ATILSTEPPA NWQIVYDIVG SSALSMIAIF ICLRFFPNQY LSVWKRALAK       180
     FIQSLEQDIE GSFSHRGPRF MQEEMTHLGM LRQYRRLIPK KYMIYTQRIS INIRNIQFSL       240
     DNLYYEAKNE AFWHGVKENL YTLRCAIKTN TSCDTPKMSI VPESKLQQYV MRCLQQAFSH       300
     WNRLCMILQH                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page