(data stored in ACNUC7421 zone)

EMBL: CP000675.PE493

CP000675.PE493       Location/Qualifiers
FT   CDS             complement(524160..524591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2909"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2909"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56810"
FT                   /protein_id="ABQ56810.1"
FT                   /translation="MHPDLKDLLDYRNHKIITRYNMDYPTAAMQAEEALHELMKFIWLC
FT                   HKHKADKLLYPDDKNLDFSCVIHAEMADIDKMWHTFLLFTRDYHEFCDTCLNGIFFHHD
FT                   PLIGENIPVSEEDYALELTRYLTYIHDHLGSETLIKWFQ"
     MHPDLKDLLD YRNHKIITRY NMDYPTAAMQ AEEALHELMK FIWLCHKHKA DKLLYPDDKN        60
     LDFSCVIHAE MADIDKMWHT FLLFTRDYHE FCDTCLNGIF FHHDPLIGEN IPVSEEDYAL       120
     ELTRYLTYIH DHLGSETLIK WFQ                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page