(data stored in ACNUC7421 zone)

EMBL: CP000675.PE496

CP000675.PE496       Location/Qualifiers
FT   CDS             complement(525619..526419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2906"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2906"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56807"
FT                   /protein_id="ABQ56807.1"
FT                   /translation="MGRSEMKIASAKLRELMKAVSEGHYETVNTILDKDPELVNQYVPP
FT                   TYDSPLARVLNKKYIDYKMLDILVKHHVDFDYPINHHKETPIELACKNQDLQLFKYLVQ
FT                   HNAPISEHAPHFLLVNSTNIKYLTEDKIKNTCEIIKLMGGLEAVSSKCNAEGNRFEELA
FT                   RKSQLINRFGGVVRYDYMQLLQSVYPIVDREVDTPTINASTEKLTNLLNKIRDQHISKE
FT                   GYDQQNLKDSISLFFMTGGEIPPSRKVPESRFEEAGIDTPKNTL"
     MGRSEMKIAS AKLRELMKAV SEGHYETVNT ILDKDPELVN QYVPPTYDSP LARVLNKKYI        60
     DYKMLDILVK HHVDFDYPIN HHKETPIELA CKNQDLQLFK YLVQHNAPIS EHAPHFLLVN       120
     STNIKYLTED KIKNTCEIIK LMGGLEAVSS KCNAEGNRFE ELARKSQLIN RFGGVVRYDY       180
     MQLLQSVYPI VDREVDTPTI NASTEKLTNL LNKIRDQHIS KEGYDQQNLK DSISLFFMTG       240
     GEIPPSRKVP ESRFEEAGID TPKNTL                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page