(data stored in ACNUC7421 zone)

EMBL: CP000675.PE497

CP000675.PE497       Location/Qualifiers
FT   CDS             526690..528690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2905"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56806"
FT                   /protein_id="ABQ56806.1"
FT                   /translation="MQNLDEILKKLGEDLKKTSKETANKLSVLSRKVAEDVVKVSDETV
FT                   QKINEVTKKLSVDTTVSTIDTQRILDDFMKNIRFSRFKQIWQAIEETPKSKHILLKSLF
FT                   LKGLLTHNKPLLEEIIRQIELIPYSSDLEMLGAFSQDKAHPLSPELLEFVQEMLANESE
FT                   KVLLTILMNAFQSIPELSLDSKTGTLSMKTKKELLPLLIANADTSIAKSIMSQLTDISF
FT                   DSVLPAFRPSIGDPSYQKTNINLSKYLSLVGDKTDISEFLILTIGLFTSLKIGDKGFLQ
FT                   ELSADYLFVRYDDCLHKIIEKLKEKEVIEQLGEEKIQKIMKAVESLQIFNPTSNDPRRF
FT                   FETRLAQYINGLSHSEKTIEIDSIGEDKEPEDEELRDNTLKACNKILQFFLGDCGRVDT
FT                   PREMEQKICIFANGYKDTSKFTKKEVEFITGVLHHAEAHKGRDRVERDKLTGIKERKFE
FT                   TDSEKVGSDVWNCGGGVMKGCSPVFYDAQRDPMRNMLVDSSTVAPDNKEGKQWFWNNNR
FT                   QYSSYVGSISGHTCNIVGMLAKYMENYKEDPDLPNDINLFLIQVIGVYAKRGFHAMLEV
FT                   IDVLHDPYVQDIFKGYGVQVNLYSYFKENPELAGFLQHAMNDATTYTQALVNKKHVKEA
FT                   LKSNSFFSKKDEESGDKKNDHTPKDGTVYGC"
     MQNLDEILKK LGEDLKKTSK ETANKLSVLS RKVAEDVVKV SDETVQKINE VTKKLSVDTT        60
     VSTIDTQRIL DDFMKNIRFS RFKQIWQAIE ETPKSKHILL KSLFLKGLLT HNKPLLEEII       120
     RQIELIPYSS DLEMLGAFSQ DKAHPLSPEL LEFVQEMLAN ESEKVLLTIL MNAFQSIPEL       180
     SLDSKTGTLS MKTKKELLPL LIANADTSIA KSIMSQLTDI SFDSVLPAFR PSIGDPSYQK       240
     TNINLSKYLS LVGDKTDISE FLILTIGLFT SLKIGDKGFL QELSADYLFV RYDDCLHKII       300
     EKLKEKEVIE QLGEEKIQKI MKAVESLQIF NPTSNDPRRF FETRLAQYIN GLSHSEKTIE       360
     IDSIGEDKEP EDEELRDNTL KACNKILQFF LGDCGRVDTP REMEQKICIF ANGYKDTSKF       420
     TKKEVEFITG VLHHAEAHKG RDRVERDKLT GIKERKFETD SEKVGSDVWN CGGGVMKGCS       480
     PVFYDAQRDP MRNMLVDSST VAPDNKEGKQ WFWNNNRQYS SYVGSISGHT CNIVGMLAKY       540
     MENYKEDPDL PNDINLFLIQ VIGVYAKRGF HAMLEVIDVL HDPYVQDIFK GYGVQVNLYS       600
     YFKENPELAG FLQHAMNDAT TYTQALVNKK HVKEALKSNS FFSKKDEESG DKKNDHTPKD       660
     GTVYGC                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page