(data stored in ACNUC7421 zone)

EMBL: CP000675.PE498

CP000675.PE498       Location/Qualifiers
FT   CDS             complement(529509..530285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2904"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2904"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56805"
FT                   /protein_id="ABQ56805.1"
FT                   /translation="MRGKREFLKHEYSPSHWSIDYTRAGTSIAVITVRNKYHYSVILNP
FT                   TDCRGYRIIIRYLNEGDSSLSSAFNRPYTVSEQRGLNDVASLMTQVYEKLGLIVQFSQL
FT                   GNNSQSFDKETGVTLIGSEEEPSMLHLHMWGRGDPDMEYIAGVPLRGPEPGLMFDLIAK
FT                   NKTHPINQHAIKWNEEELQACLAMFKLKLAEYVNSPEFTEEFGDTLKVTIHDKKDLGEA
FT                   KESGFGFFHKMKSASDGITTLEKTLALEDDKINPFV"
     MRGKREFLKH EYSPSHWSID YTRAGTSIAV ITVRNKYHYS VILNPTDCRG YRIIIRYLNE        60
     GDSSLSSAFN RPYTVSEQRG LNDVASLMTQ VYEKLGLIVQ FSQLGNNSQS FDKETGVTLI       120
     GSEEEPSMLH LHMWGRGDPD MEYIAGVPLR GPEPGLMFDL IAKNKTHPIN QHAIKWNEEE       180
     LQACLAMFKL KLAEYVNSPE FTEEFGDTLK VTIHDKKDLG EAKESGFGFF HKMKSASDGI       240
     TTLEKTLALE DDKINPFV                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page