(data stored in ACNUC7421 zone)

EMBL: CP000675.PE499

CP000675.PE499       Location/Qualifiers
FT   CDS             530651..530863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2903"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2903"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56804"
FT                   /protein_id="ABQ56804.1"
FT                   /translation="MDIHSTYKMLAKMQGNKELSSHKIAETEQAEAETVPQLKLQAEPE
FT                   AKPDMQNILSNMLGISSNKKHSPMD"
     MDIHSTYKML AKMQGNKELS SHKIAETEQA EAETVPQLKL QAEPEAKPDM QNILSNMLGI        60
     SSNKKHSPMD                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page