(data stored in ACNUC7421 zone)

EMBL: CP000675.PE512

CP000675.PE512       Location/Qualifiers
FT   CDS             543422..543763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2890"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56791"
FT                   /protein_id="ABQ56791.1"
FT                   /translation="MADPTCTGGTVACWIVSQANILANIANQLEPVQRLITGGAYLIGC
FT                   AFIFKAIYSLKVYGEARTMMSSNTSMKEPVMYLMVGALLIYFPSLVSSVLPNDFWLLAI
FT                   PLAYSRKFE"
     MADPTCTGGT VACWIVSQAN ILANIANQLE PVQRLITGGA YLIGCAFIFK AIYSLKVYGE        60
     ARTMMSSNTS MKEPVMYLMV GALLIYFPSL VSSVLPNDFW LLAIPLAYSR KFE              113
//

If you have problems or comments...

PBIL Back to PBIL home page