(data stored in ACNUC7421 zone)

EMBL: CP000675.PE534

CP000675.PE534       Location/Qualifiers
FT   CDS             complement(569611..569910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2868"
FT                   /product="sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2868"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56769"
FT                   /protein_id="ABQ56769.1"
FT                   /translation="MQINITGHGMDVTPALRAFTEEKFDKLERHFDHIRAINVVFDVEK
FT                   VRQIAEATVLVTKGELHASSESEDMYAAIDTLVDKLNRQLIKHKEKLLAHRDRD"
     MQINITGHGM DVTPALRAFT EEKFDKLERH FDHIRAINVV FDVEKVRQIA EATVLVTKGE        60
     LHASSESEDM YAAIDTLVDK LNRQLIKHKE KLLAHRDRD                               99
//

If you have problems or comments...

PBIL Back to PBIL home page