(data stored in ACNUC7421 zone)

EMBL: CP000675.PE541

CP000675.PE541       Location/Qualifiers
FT   CDS             574118..575605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2861"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56762"
FT                   /protein_id="ABQ56762.1"
FT                   /translation="MDFVSEMNKILQMELEQFKEFIQKKLEEDKNYLEKLFWLPNGSQM
FT                   TVLNYLIEQYSEPKLGIDDANRDLLAKIDFVLHEAKDVNVGEPLHQAIVAGKISLALHL
FT                   LGVDENNFTPGESEKTDVLSILSKVKKKIEESFNHVKRCFFDVDKRDGYGRTLLSLALD
FT                   AKRQELLIAILARNPIVHATTLRSSAYVPFQPIHQAVVLDYAEGITLLASMGAQLTNPL
FT                   GSMRDTPVILAARLGKINALAALLELPTQSLSLESENNHLFEDKQTGHTAVEELCERMA
FT                   NENDKAEALRGIAMLICRGAEPPRNEKMRNLLSSNRVAFLKAVSTYLADKPQLVDAFVE
FT                   RCHLRESALHNIVYADHSWGSSIRHLLGVPSEAALIVEELVTRKYSDPSFASENVSSLS
FT                   TTATENLRSERNPLKLYAEFVRRYTQAYDSQMITNRWSTMRWMIAEGNCDWDTVVRYSK
FT                   NHPTSRTRIVLNEMFNPIPRVHEDIESQQNSPRVVLK"
     MDFVSEMNKI LQMELEQFKE FIQKKLEEDK NYLEKLFWLP NGSQMTVLNY LIEQYSEPKL        60
     GIDDANRDLL AKIDFVLHEA KDVNVGEPLH QAIVAGKISL ALHLLGVDEN NFTPGESEKT       120
     DVLSILSKVK KKIEESFNHV KRCFFDVDKR DGYGRTLLSL ALDAKRQELL IAILARNPIV       180
     HATTLRSSAY VPFQPIHQAV VLDYAEGITL LASMGAQLTN PLGSMRDTPV ILAARLGKIN       240
     ALAALLELPT QSLSLESENN HLFEDKQTGH TAVEELCERM ANENDKAEAL RGIAMLICRG       300
     AEPPRNEKMR NLLSSNRVAF LKAVSTYLAD KPQLVDAFVE RCHLRESALH NIVYADHSWG       360
     SSIRHLLGVP SEAALIVEEL VTRKYSDPSF ASENVSSLST TATENLRSER NPLKLYAEFV       420
     RRYTQAYDSQ MITNRWSTMR WMIAEGNCDW DTVVRYSKNH PTSRTRIVLN EMFNPIPRVH       480
     EDIESQQNSP RVVLK                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page