(data stored in ACNUC7421 zone)

EMBL: CP000675.PE545

CP000675.PE545       Location/Qualifiers
FT   CDS             579812..580093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2857"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2857"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56758"
FT                   /protein_id="ABQ56758.1"
FT                   /translation="MGSIIGVEKNYFWKRMDDGSKPGYAEIIREKTAVIRPAGGVIGFL
FT                   PNDIHSVMNESDDVAISLHVYGKNLNYTGRHQYDPVNNLMQPFIVNYS"
     MGSIIGVEKN YFWKRMDDGS KPGYAEIIRE KTAVIRPAGG VIGFLPNDIH SVMNESDDVA        60
     ISLHVYGKNL NYTGRHQYDP VNNLMQPFIV NYS                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page