(data stored in ACNUC7421 zone)

EMBL: CP000675.PE549

CP000675.PE549       Location/Qualifiers
FT   CDS             582244..582912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2853"
FT                   /product="amino acid (glutamine) ABC transporter, ATP
FT                   binding component"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2853"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56754"
FT                   /protein_id="ABQ56754.1"
FT                   /translation="MLQVINASKKIGNAQVLNEINLSIQANSIVGLVGPSGSGKTTLLR
FT                   CIQQLESIDSGSIQCEGKSGFMFQDFQLFPHMTVLNNLIYAPYLHDKTADHMANAWALL
FT                   AMLGLSDKAHSYPQGLSGGQKQRVALARSLMMKPDLLLCDEPTSGLDMATTNDVIALLN
FT                   TVKTLKITMLIASHDLFFLSNIAERLLVVKQGQLIADFKTQEVSDPILYLQQFYQGEIL
FT                   "
     MLQVINASKK IGNAQVLNEI NLSIQANSIV GLVGPSGSGK TTLLRCIQQL ESIDSGSIQC        60
     EGKSGFMFQD FQLFPHMTVL NNLIYAPYLH DKTADHMANA WALLAMLGLS DKAHSYPQGL       120
     SGGQKQRVAL ARSLMMKPDL LLCDEPTSGL DMATTNDVIA LLNTVKTLKI TMLIASHDLF       180
     FLSNIAERLL VVKQGQLIAD FKTQEVSDPI LYLQQFYQGE IL                          222
//

If you have problems or comments...

PBIL Back to PBIL home page