(data stored in ACNUC7421 zone)

EMBL: CP000675.PE554

CP000675.PE554       Location/Qualifiers
FT   CDS             588212..589327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2848"
FT                   /product="leucine-, isoleucine-, valine-, threonine-, and
FT                   alanine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2848"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56749"
FT                   /protein_id="ABQ56749.1"
FT                   /translation="MPYFYTRSAPLFFVFVIALIFINFSYAHEFQTDSKNKHKVDVHIG
FT                   IYAPFSSHSAFIGRNILAAMEMGSERIQSSDIHYSFYTLDQLPKNKNAGLVLQKFIDTH
FT                   HINVLVTGGKETGLIAAPIAKKNNLIHFSLTNNTEVADGRNNFIVWSPAYDQAKVLVNE
FT                   LKRQQVHHLGIITANQPSSTALTHSVIKQLQADSHIDVAASEYFEPGNKDFSRLANRIK
FT                   RKNADMYLVMASPEDIKLIQEQMEADKQHVPITSIVERATPEVVKVFEGQWYVDSHEMQ
FT                   PDFINEFKKNYLNYPVTEAGYAFDLFQLLNKSIVMAIKTQGSPTSQEVVHQLHDIANGT
FT                   GVMGTMVLDSKGSLFTKSEVKTVKNGEIHTV"
     MPYFYTRSAP LFFVFVIALI FINFSYAHEF QTDSKNKHKV DVHIGIYAPF SSHSAFIGRN        60
     ILAAMEMGSE RIQSSDIHYS FYTLDQLPKN KNAGLVLQKF IDTHHINVLV TGGKETGLIA       120
     APIAKKNNLI HFSLTNNTEV ADGRNNFIVW SPAYDQAKVL VNELKRQQVH HLGIITANQP       180
     SSTALTHSVI KQLQADSHID VAASEYFEPG NKDFSRLANR IKRKNADMYL VMASPEDIKL       240
     IQEQMEADKQ HVPITSIVER ATPEVVKVFE GQWYVDSHEM QPDFINEFKK NYLNYPVTEA       300
     GYAFDLFQLL NKSIVMAIKT QGSPTSQEVV HQLHDIANGT GVMGTMVLDS KGSLFTKSEV       360
     KTVKNGEIHT V                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page