(data stored in ACNUC7421 zone)

EMBL: CP000675.PE563

CP000675.PE563       Location/Qualifiers
FT   CDS             598666..600978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2839"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2839"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56740"
FT                   /protein_id="ABQ56740.1"
FT                   /translation="MKKVSNKLILGVCCSTLLAWSSQSFSSDTFIVKGIRVNGLQRVST
FT                   GTVLNYMPVQVGEEISSSSTAQIIRALYETGFFQSVSLERQGNVLVVNVIERATIGSIT
FT                   VVGNKEIPSDKMKAFLKEMGLVKGRVFQRSSLERLEKELKQAYTARGKYNSRIETKVTP
FT                   LTENRVAISITVSEGRVSRIKEIKIIGNHDFKANELLPELTLSTSNLFTYFTKKDQYSK
FT                   PGMDASLEALRSFYLDRGYLKFNVVSSQVLLSPDKKDVYINIHIEEGPQYHFSGYDVVG
FT                   KTILPKEKIDSLIQVKKGDVFSRKKVTESISAIGLALGDVGYGFPAINAEPRIDENNKT
FT                   VFITFVVQPGRHVYVRRINFHGNTKTGDYVLRNVIRQDEGGLLSLHNIKESERQLRMLG
FT                   YLKNIDVKTTPVPGTNNQVDLDVNVEEAPSAEASASMGYGTNGYQFNASVNQRNFMGSG
FT                   RSMGAAFNASQWGQDYSFNYYNPFYTDTGVGRGGSLYYSRIDPKNLNVSTYSSNRYGGD
FT                   ISYNFPLGEKSSFQLGYGYQDINIKSVGYVLPIINFVALNGNHFQEIRLTSGWSRNSYD
FT                   QMPYPNQGFNQQAIAMVALPATSQSLSYYKSSYQAHLYYPLTRGWIFSVLGNVGYGNTF
FT                   DNFGLPFFENYYAGGPVQPGQVRGYDSYSLGPQDNFGNAMGANFLVNGSVGLILPYPLS
FT                   RDNVRTTIFADAGNVFASGTPPALRGTPAGPMRYSAGVSLEWRSPFGPLSFSLAKALNP
FT                   QPLDQTQLFQFALSSGF"
     MKKVSNKLIL GVCCSTLLAW SSQSFSSDTF IVKGIRVNGL QRVSTGTVLN YMPVQVGEEI        60
     SSSSTAQIIR ALYETGFFQS VSLERQGNVL VVNVIERATI GSITVVGNKE IPSDKMKAFL       120
     KEMGLVKGRV FQRSSLERLE KELKQAYTAR GKYNSRIETK VTPLTENRVA ISITVSEGRV       180
     SRIKEIKIIG NHDFKANELL PELTLSTSNL FTYFTKKDQY SKPGMDASLE ALRSFYLDRG       240
     YLKFNVVSSQ VLLSPDKKDV YINIHIEEGP QYHFSGYDVV GKTILPKEKI DSLIQVKKGD       300
     VFSRKKVTES ISAIGLALGD VGYGFPAINA EPRIDENNKT VFITFVVQPG RHVYVRRINF       360
     HGNTKTGDYV LRNVIRQDEG GLLSLHNIKE SERQLRMLGY LKNIDVKTTP VPGTNNQVDL       420
     DVNVEEAPSA EASASMGYGT NGYQFNASVN QRNFMGSGRS MGAAFNASQW GQDYSFNYYN       480
     PFYTDTGVGR GGSLYYSRID PKNLNVSTYS SNRYGGDISY NFPLGEKSSF QLGYGYQDIN       540
     IKSVGYVLPI INFVALNGNH FQEIRLTSGW SRNSYDQMPY PNQGFNQQAI AMVALPATSQ       600
     SLSYYKSSYQ AHLYYPLTRG WIFSVLGNVG YGNTFDNFGL PFFENYYAGG PVQPGQVRGY       660
     DSYSLGPQDN FGNAMGANFL VNGSVGLILP YPLSRDNVRT TIFADAGNVF ASGTPPALRG       720
     TPAGPMRYSA GVSLEWRSPF GPLSFSLAKA LNPQPLDQTQ LFQFALSSGF                  770
//

If you have problems or comments...

PBIL Back to PBIL home page