(data stored in ACNUC7421 zone)

EMBL: CP000675.PE570

CP000675.PE570       Location/Qualifiers
FT   CDS             605811..606035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2832"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56733"
FT                   /protein_id="ABQ56733.1"
FT                   /translation="MKHFDFSLRIWPKIIDINGKEKYFFRDYLLSHPEAAEKYQQLKIK
FT                   LAQEHKYDREQYTDAKSEFINQILKLAQN"
     MKHFDFSLRI WPKIIDINGK EKYFFRDYLL SHPEAAEKYQ QLKIKLAQEH KYDREQYTDA        60
     KSEFINQILK LAQN                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page