(data stored in ACNUC7421 zone)

EMBL: CP000675.PE574

CP000675.PE574       Location/Qualifiers
FT   CDS             607777..608589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2828"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2828"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56729"
FT                   /protein_id="ABQ56729.1"
FT                   /translation="MSMYDKRQFFKTYFSSASEKSILVKLLDKRFHPPFHTANILDLGC
FT                   HDGALMKNIVNAYAKRLPEKLVITGVDPSLQAIKEYAKADFPIPVQTNTFAGTAEDYFD
FT                   VCTDHFDWIFASQCLYWSPDLPKIIKQIHEAGDSALIVIRGCHGIYEIQSQFRHYIGNH
FT                   LEKFYTDKEVEMALRTQKILFQKESLSTSIRLPDKDSIELKWLILFFLQMEEESLGDKI
FT                   FCEVRDWITSRASGSIHHEVHFFWLGNAIFTGDYNRNFPVKSKKNSMG"
     MSMYDKRQFF KTYFSSASEK SILVKLLDKR FHPPFHTANI LDLGCHDGAL MKNIVNAYAK        60
     RLPEKLVITG VDPSLQAIKE YAKADFPIPV QTNTFAGTAE DYFDVCTDHF DWIFASQCLY       120
     WSPDLPKIIK QIHEAGDSAL IVIRGCHGIY EIQSQFRHYI GNHLEKFYTD KEVEMALRTQ       180
     KILFQKESLS TSIRLPDKDS IELKWLILFF LQMEEESLGD KIFCEVRDWI TSRASGSIHH       240
     EVHFFWLGNA IFTGDYNRNF PVKSKKNSMG                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page