(data stored in ACNUC7421 zone)

EMBL: CP000675.PE576

CP000675.PE576       Location/Qualifiers
FT   CDS             complement(609848..610696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2826"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2826"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56727"
FT                   /protein_id="ABQ56727.1"
FT                   /translation="MTDLRTEIESLIHEGLLPDREYVSAKRFINHYATTSKFWDGLALV
FT                   GITPIINGLYAGYYASRAVWATLRTVGNLLILKPGLAFDAIKDVGCHLTLSTCLLLMAP
FT                   IHALTHAVELLTRVISSWFVGQEQRYDLLETGLMAKWANRANGYQMVNELPSSNYFNKA
FT                   RFFSSYNNAWDCLEQMASPITSLAKSGFHSLVEALYGVDSAIECIVNLAICKPLHAKEN
FT                   FYNLQVHFGLALSLAVMAPINALVEGIAFMTRLGTTWVSACLKPEVTETEQENTTAYQF
FT                   N"
     MTDLRTEIES LIHEGLLPDR EYVSAKRFIN HYATTSKFWD GLALVGITPI INGLYAGYYA        60
     SRAVWATLRT VGNLLILKPG LAFDAIKDVG CHLTLSTCLL LMAPIHALTH AVELLTRVIS       120
     SWFVGQEQRY DLLETGLMAK WANRANGYQM VNELPSSNYF NKARFFSSYN NAWDCLEQMA       180
     SPITSLAKSG FHSLVEALYG VDSAIECIVN LAICKPLHAK ENFYNLQVHF GLALSLAVMA       240
     PINALVEGIA FMTRLGTTWV SACLKPEVTE TEQENTTAYQ FN                          282
//

If you have problems or comments...

PBIL Back to PBIL home page