(data stored in ACNUC7421 zone)

EMBL: CP000675.PE577

CP000675.PE577       Location/Qualifiers
FT   CDS             complement(611033..611500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2825"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56726"
FT                   /protein_id="ABQ56726.1"
FT                   /translation="MNAENNVLNTLNSLSKEINKLYGYVTIAGDNFGEPAINSGPCGPF
FT                   ANAFYKIWNQKFTEKVNIAFIMMKNSDECWHILIRLPNGLLFDGGFGVHNEDKWNKDTF
FT                   DIEDMLEYDLQLLEKHSGGLNRTYPRCCPDFSIDVITNLIHKHLELVEKNK"
     MNAENNVLNT LNSLSKEINK LYGYVTIAGD NFGEPAINSG PCGPFANAFY KIWNQKFTEK        60
     VNIAFIMMKN SDECWHILIR LPNGLLFDGG FGVHNEDKWN KDTFDIEDML EYDLQLLEKH       120
     SGGLNRTYPR CCPDFSIDVI TNLIHKHLEL VEKNK                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page