(data stored in ACNUC7421 zone)

EMBL: CP000675.PE583

CP000675.PE583       Location/Qualifiers
FT   CDS             614497..615231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2819"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56720"
FT                   /protein_id="ABQ56720.1"
FT                   /translation="MKEYISALSIDRLTSYEILCPSKVDTDIIGAYHWNLLISQAFYPF
FT                   IHSVEVALRNSIHHAATKKFENEFWFDIVVTDGKSRSILEDTKNDLHRRFGQVTASDIV
FT                   AGLTFGFWTNLIKQKTYTDQFNPNRLWPDLIPSVFPHYARGHDDRKNISKRFEEIRLIR
FT                   NRLFHHEPIWKFKNAQTPQECIAELRRKFNDTFKAIGWISKYKRNCLREFGFVESFKNN
FT                   CTLETLESYKVKGAEILQQLAD"
     MKEYISALSI DRLTSYEILC PSKVDTDIIG AYHWNLLISQ AFYPFIHSVE VALRNSIHHA        60
     ATKKFENEFW FDIVVTDGKS RSILEDTKND LHRRFGQVTA SDIVAGLTFG FWTNLIKQKT       120
     YTDQFNPNRL WPDLIPSVFP HYARGHDDRK NISKRFEEIR LIRNRLFHHE PIWKFKNAQT       180
     PQECIAELRR KFNDTFKAIG WISKYKRNCL REFGFVESFK NNCTLETLES YKVKGAEILQ       240
     QLAD                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page