(data stored in ACNUC7421 zone)

EMBL: CP000675.PE585

CP000675.PE585       Location/Qualifiers
FT   CDS             616462..616881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2817"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2817"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56718"
FT                   /protein_id="ABQ56718.1"
FT                   /translation="MNSHTSKYAERNRPIRRIERFILKIMIFVVIPISCILGIVYPTSK
FT                   ISNSLPVLFSLAGLIQLEVAGLFEYIDYLGNELEKIYDKSGRVPSNITRAIYEYYNPEP
FT                   TVKAFINNQLYLNKRVGFYLLLIGGLIQLFTIWLE"
     MNSHTSKYAE RNRPIRRIER FILKIMIFVV IPISCILGIV YPTSKISNSL PVLFSLAGLI        60
     QLEVAGLFEY IDYLGNELEK IYDKSGRVPS NITRAIYEYY NPEPTVKAFI NNQLYLNKRV       120
     GFYLLLIGGL IQLFTIWLE                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page