(data stored in ACNUC7421 zone)

EMBL: CP000675.PE591

CP000675.PE591       Location/Qualifiers
FT   CDS             620323..620700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2811"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56712"
FT                   /protein_id="ABQ56712.1"
FT                   /translation="MNQLSSFNHKKIWMMGAVILFLFLMTHPASASTAGGGLPFDSWLT
FT                   KIQKSITGPFAFSAAIIGLVAAGATLIFGGELNGFMRTLVFFVLVLSFLVAAQNTMTAI
FT                   TGKGAEISKPSVEMTAIESQP"
     MNQLSSFNHK KIWMMGAVIL FLFLMTHPAS ASTAGGGLPF DSWLTKIQKS ITGPFAFSAA        60
     IIGLVAAGAT LIFGGELNGF MRTLVFFVLV LSFLVAAQNT MTAITGKGAE ISKPSVEMTA       120
     IESQP                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page