(data stored in ACNUC7421 zone)

EMBL: CP000675.PE592

CP000675.PE592       Location/Qualifiers
FT   CDS             620751..620996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /locus_tag="LPC_2810"
FT                   /product="Conjugal transfer protein trbD"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2810"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56711"
FT                   /protein_id="ABQ56711.1"
FT                   /translation="MGGDRELVMFSGLLSAILVFAAQDWLAAIAGIVMWFLSLKGLRLM
FT                   AKSDPYMRAVYLRQRRYQAYYPARSTPFRENKRGYQ"
     MGGDRELVMF SGLLSAILVF AAQDWLAAIA GIVMWFLSLK GLRLMAKSDP YMRAVYLRQR        60
     RYQAYYPARS TPFRENKRGY Q                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page